Home - Products - Others - Other Targets - Pyridoxal 5-phosphate monohydrate

Pyridoxal 5-phosphate monohydrate

CAS No. 41468-25-1

Pyridoxal 5-phosphate monohydrate( Pyridoxal phosphate monohydrate )

Catalog No. M21332 CAS No. 41468-25-1

Pyridoxal 5-phosphate monohydrate is an active vitamin B6 metabolite.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
500MG 26 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Pyridoxal 5-phosphate monohydrate
  • Note
    Research use only, not for human use.
  • Brief Description
    Pyridoxal 5-phosphate monohydrate is an active vitamin B6 metabolite.
  • Description
    Pyridoxal 5-phosphate monohydrate is an active vitamin B6 metabolite.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Pyridoxal phosphate monohydrate
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    41468-25-1
  • Formula Weight
    265.16
  • Molecular Formula
    C8H12NO7P
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:22 mg/mL (82.96 mM)
  • SMILES
    Cc(ncc(COP(O)(O)=O)c1C=O)c1O.O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Carlos Alberto Calderón㎡spina Mauricio Orlando Nava㎝esa. B Vitamins in the nervous system: Current knowledge of the biochemical modes of action and synergies of thiamine pyridoxine and cobalamin[J]. Cns Neuroscience & Therapeutics 2019(2).
molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 7-Z-Trifostigmanosid...

    7-Z-Trifostigmanoside I is a natural product from Polygala hongkongensis Hemsl.

  • coreopsin

    Coreopsin is one of the main components from Coreopsis tinctoria Nutt. Flower(CTF). CTF has been used traditionally in China for treating hypertension and diabetes as well as reducing body weight and blood fat.